while looking up for the picture of the book with the longest title on my previous post, i came accross this site called THE LONGEST LIST OF THE LONGEST STUFF AT THE LONGEST DOMAIN NAME AT LONG LAST . remove the spaces and add .com and you got yourself the url of the site.
here are some interesting info that i found:
What is the longest job title in the world?
London, England News Ad:Wanted: Temporary part-time libraries North-West inter-library loan business unit administration assistant.
How long was the longest lecture in the world?
From March 21 - 25 Errol Muzawazi, of Zimbabwe, gave a lecture on 'Democracy' in Poland lasting an incredible 88 hours and 04 seconds, beating his previous record of 62 hours 30 minutes.
Errol Muzawazi was able to take only a short break every 8 hours to eat, go to the bathroom and take a quick nap. His audience was not bound by the same rules and Errol was often found talking to himself as the audience slept.
So what exactly is the longest word in the world?
It all depends on your point of view, but here goes:
Officially the longest word is 'floccinaucinihilipilification' at 29 characters, meaning 'the act of estimating as worthless'.
Then there's 'antidisestablishmentarianism' at 28 letters, meaning 'opposition to the disestablishment of the Church of England'. It is often considered the longest word as it has an actual meaning instead of being created just to be long.
Unofficially the longest word is 'pneumonoultramicroscopicsilicovolcanoconiosis' at 45 characters, meaning 'a lung disease'. It was created solely for the purpose of being the longest word, however, it does appear in a few dictionaries.
What is the world's longest place name?
A little village in Wales boasts the longest place name at 58 letters:Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch...
...But New Zealand makes the same claim with a hill containing 92 letters:Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu...
...But after some further digging we found the winner to be Bangkok. OK, so that's only 7 letters, but the official ceremonial name of Bangkok is Krung Thep Mahanakhon for short meaning 'City of Angels'.
The full name of Bangkok has many variations in spelling but we found what is believed to be the official spelling coming in at 163 letters:Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
Subscribe to:
Post Comments (Atom)

No comments:
Post a Comment